Search results


Species: Taenia solium
Id: Scaffold00146.gene7151
Length: 465
Strand: +
Start: 126121
Stop: 131246
Annotation: K08893 IPR020635|IPR001245|IPR011009 GO:0004672|GO:0006468|GO:0004713|GO:0016772 Q70DV1
Function: Tyrosine-protein kinase, catalytic domain|Serine-threonine/tyrosine-protein kinase|Protein kinase-like domain
Scaffold: Scaffold00146
Sequence:
>Scaffold00146.gene7151
ATGATCCACAATCAAGAATACGTGGCGCACGCAGGCGCGCGTTTTCCAATCAAATGGACAGCACCAGAGGCAGCGAATTACTCCCGTTTTACCACTGCTTCTGACGTCTGGTCCTTCGGCATTCTCTTGACGGAGATAGTAACCTACGGGAGGGTCCCCTACCCCGGCATGCATAATGCAGAGGTGTTGCGCCAAGTAGAGGCTGGCTACCGAATGCCGGCCCCGCCGGGGTGCCCCGCGGAGCTCTATGACCTCATGCTCGAGTGTTGGGCTGCTGATGAGGCTGCGCGTCCCTCCTTTGCCAGCATCCATGGCCGTCTGCAAGTCTTTTGCGAGGAGTGGGACCGCCCCGCTTACCGCGATCCCGCCACCGCTGCCGGAGTGAGCACCACCTCCGAGCGGTGTGAAAGTCCGCTGCCTCCCCTTCCTCTCTACCGTCGCCACATCACGGCACGCCAAAACTGA

>Scaffold00146.gene7151
MIHNQEYVAHAGARFPIKWTAPEAANYSRFTTASDVWSFGILLTEIVTYGRVPYPGMHNAEVLRQVEAGYRMPAPPGCPAELYDLMLECWAADEAARPSFASIHGRLQVFCEEWDRPAYRDPATAAGVSTTSERCESPLPPLPLYRRHITARQN*