Search results


Species: Taenia solium
Id: Scaffold00125.gene6684
Length: 498
Strand: +
Start: 32165
Stop: 38008
Annotation: K05699 IPR001715 GO:0005515 C7TYB0
Function: Calponin homology domain
Scaffold: Scaffold00125
Sequence:
>Scaffold00125.gene6684
ATGGCGAATAATCCCTTCAAGCAGGCCGACAAAGCCGCCAACCCTACCGGAGCTAAACCGAACTTTACTACCTCCAAACGACCGGGCGCCGCCTCGGCCAAGGAGATTATGCTGCACTGGTGCCAGGTCATGACCAAGGGATATCCGCATGTGGAGGTGAAAAACTTTGGAAGCAGCTGGGCGGACGGAATGGCTTTCTGTGCGCTCATTCATCACTTCTACCCTGACGCTTTCGATTTCTCCACTCTGAAACCGGAAAACCGGAGAGCCAACTTTGAACTTGCATTTAAAACTGCCGAGGAGCTGGGCAACGTGGCACCACTTTTAGACGTAGAGGATTTGCTGAGAACTAAAGTACCCGATTGGAAGTGCATCTTCACTCAAATTCAGCTCTACTACCGTCGGTTCCAATTGGAACAGGGCACTAAGGCCAACAAGCCTCCAGTGGGTCTCCATCCCTCCGCGCCCCCACCTGCCTCCGAGGGCAGCTCCACTTAA

>Scaffold00125.gene6684
MANNPFKQADKAANPTGAKPNFTTSKRPGAASAKEIMLHWCQVMTKGYPHVEVKNFGSSWADGMAFCALIHHFYPDAFDFSTLKPENRRANFELAFKTAEELGNVAPLLDVEDLLRTKVPDWKCIFTQIQLYYRRFQLEQGTKANKPPVGLHPSAPPPASEGSST*