Search results


Species: Taenia solium
Id: LongOrf.asmbl_2297
Length: 470
Strand: -
Start: 1183535
Stop: 1184174
Annotation: K10047 IPR000760|IPR020583 GO:0004437 C4QMF3
Function: Inositol monophosphatase|Inositol monophosphatase, metal-binding site
Scaffold: Scaffold00004
Sequence:
>LongOrf.asmbl_2297
ATGTTAGATTTCGCTAAAAACATTGCTAAGGAGGCTGGATCTCTCATTGTTAGTGCCTTTGACCAGCCGCCACATTATCACGAAAAGGTCTCCTTCGCCGACCTCGTTACGGACACCGATAAACAAGTTGAAGACTTGGTCAAGTCTCGAATTCTCGAAACCTATTCTGATCATAAAATCATAGCAGAGGAAAGCGCCTCTGGTCGATCCATTTTGACGTCAGACCCTACTTGGATCGTCGATCCAATTGACGGGACCTCCAACTTTGTTAGCAAATTTCCATTTTGCGCTGTGTGCATTGGTTTTTATAAAGAAAAGCAAGCTCAGTTCGCTGTTGTTTATAACCCAATATGCGATCAAATGTTCTATGCAGAACGAGGCAAGGGTGCATTTATGAATGGCCGGGGCTTACGTGTTTCTCAATGTACTGAGTTGCACAATGCTCTCATACTTACCGATTGGGGCGGTGA

>LongOrf.asmbl_2297
MLDFAKNIAKEAGSLIVSAFDQPPHYHEKVSFADLVTDTDKQVEDLVKSRILETYSDHKIIAEESASGRSILTSDPTWIVDPIDGTSNFVSKFPFCAVCIGFYKEKQAQFAVVYNPICDQMFYAERGKGAFMNGRGLRVSQCTELHNALILTDWGG