Search results


Species: Taenia solium
Id: LongOrf.asmbl_22093
Length: 660
Strand: -
Start: 15305
Stop: 16093
Annotation: K07860 IPR005225|IPR001806|IPR003579|IPR020849|IPR003578 GO:0003924|GO:0005525|GO:0006184|GO:0007165|GO:0016020|GO:0007264|GO:0015031|GO:0005622 Q201V6
Function: Small GTP-binding protein domain|Small GTPase superfamily|Small GTPase superfamily, Rab type|Small GTPase superfamily, Ras type|Small GTPase superfamily, Rho type
Scaffold: Scaffold00271
Sequence:
>LongOrf.asmbl_22093
GCACAACAGATGCATGCTGAGCCATTCTCGCGCTCAATGACTGAGAAATCTATAAAGTGTGTTGCCGTGGGAGATGGAACGGTGGGCAAAACCTGTCTTATCCTCCGCTACACCTTGGGGGATCTAAGTAGTCTCGGTGTCTACGTACCTACAATTGCAGACACCTATTCCATTAAATTGACGGCTGGAAACACTCCTGTTCTACTTAGTCTATGGGATACGGCTGGTAAGGTATCCAGCTGCTCGCTCACCTTACCGTTTCTTCTTAAAGGTCAACAGGACTATGAGCGGCTGAGACAACTTTCATATCCCCAAACTAACATCTTCCTTGTCTGTTTCGCTGTAAATAACACCGATTCCTTCCGCAATGCTCAAGATTTGTGGGTTCCTGAGGTTAGACACTTCTGTCCAAATGCGCTGGTTCTTCTGGTGGGGACCAAAATAGACGAAAGAGGCGTCGATGGAGAGGAGTCACGCAGAGGGCAACTGACTATCTCCAGTCCTAAGGGCCTTCAATTAGCAAAGCGTTTGAAAGTTGATGGTTATGTTGAATGCTCAGCGATCACAGGCGAGGGAGTAAAGAACGTTTTCGATACAGCCATTAGGTTGGCTGTGGCTTACAAGACACCACTCAAAAGGCGCGCATGCTCTATCATGTAG

>LongOrf.asmbl_22093
AQQMHAEPFSRSMTEKSIKCVAVGDGTVGKTCLILRYTLGDLSSLGVYVPTIADTYSIKLTAGNTPVLLSLWDTAGKVSSCSLTLPFLLKGQQDYERLRQLSYPQTNIFLVCFAVNNTDSFRNAQDLWVPEVRHFCPNALVLLVGTKIDERGVDGEESRRGQLTISSPKGLQLAKRLKVDGYVECSAITGEGVKNVFDTAIRLAVAYKTPLKRRACSIM*