Search results


Species: Taenia solium
Id: LongOrf.asmbl_19539
Length: 552
Strand: -
Start: 3429
Stop: 4555
Annotation: K07863 IPR002041|IPR005225|IPR001806|IPR003579|IPR020849|IPR003578 GO:0003924|GO:0005525|GO:0006184|GO:0007165|GO:0016020|GO:0007264|GO:0015031|GO:0005622|GO:0006886|GO:0006913 Q6PW11
Function: Ran GTPase|Small GTP-binding protein domain|Small GTPase superfamily|Small GTPase superfamily, Rab type|Small GTPase superfamily, Ras type|Small GTPase superfamily, Rho type
Scaffold: Scaffold00176
Sequence:
>LongOrf.asmbl_19539
ATGCCTCTTTCTACCATTAAGTGCGTTTTCGTTGGTGATGGTGCGGTCGGAAAAACTTGCTTACTAATGAAGAAGGCGACCGGCACGTTTCCTCAATCTTATTTGCCGACAGTGTTCGACAATTATACAGTGCCTATTGAAATAGGAAAGACTGCATATCAATTTAGTTTAGTAGATACAGCAGGCCAAGAGGGGTATGAGGCACTCAGAAGGCAGGTTTATCATGGTGCTGGCGTATTTGTATTGTGTTTCGCCGTGGATCTTCGAAGTTCCTTCTCTAACGTCGCAAACAAGTGGGTTCAAGATATTAGAGCTATTTGTGCGACAACACCAATTCTCCTAGTTGGCTGTAAAACCGACGTTCGCTTAAAGCCCGGTATGAATTCAATATCGTATTCTGAAGGGAAAAAGCTTGCAAAAGAAATTGGAGCGGTGCAATATGTAGAATGCTCAGCTTTGACAAATGATGGTCTTGATGATGTTTTCGCTAAAGCCGCTCTGATCGGTGCTGGTTTGCTAACCAAAAAACGGTCGCGTTGCTCGATAATGTAA

>LongOrf.asmbl_19539
MPLSTIKCVFVGDGAVGKTCLLMKKATGTFPQSYLPTVFDNYTVPIEIGKTAYQFSLVDTAGQEGYEALRRQVYHGAGVFVLCFAVDLRSSFSNVANKWVQDIRAICATTPILLVGCKTDVRLKPGMNSISYSEGKKLAKEIGAVQYVECSALTNDGLDDVFAKAALIGAGLLTKKRSRCSIM*