Search results


Species: Taenia solium
Id: LongOrf.asmbl_18554
Length: 2172
Strand: +
Start: 75641
Stop: 80984
Annotation: K12667 IPR008814 GO:0004579|GO:0005789|GO:0008250|GO:0018279 C4Q8H5
Function: Ribophorin II
Scaffold: Scaffold00155
Sequence:
>LongOrf.asmbl_18554
CGTTCGTCAAAATTGTTTCGGAACAAATCTGTTGATTCCGTGTTAGAAGTGGATTGGTCCACCGCTTTTGCCGCGTTGTGCTTTGAAATGGTCACAATTTGGTGTTTCTTCGCCCTTCTAGCGGCGGAGGTTATCGCTGCTCCTAATTCAAACTCATCACCTGCTCTCCCGATTGGCGCTTTGGACGCAAAGGATGTGGCCCACTTCCTGGCCGTATTCAGTGATTTTAACAAAGATAACGTCAAGGATGCTCACTACGCTTACATTGGTGACTCTGTTTTCAATCAAAATATTCTGTATGGTTTGTTCTGCGACCACTTGAAGTCCCACTTTGACTCCCTCGATGCAGAGATGCAATACTACGCTCTTTCTGCTGCAAGAGGGGTTAAATCTTGTACTCCCGAGGTTTCACAACCAAACCAGCTGAAGGACACCTTGAAAAAGGAAAAATTAACGGTGGATCAACTATATTACCTTGTCTCTAGTGCAAACATTGCTCAAGTCAGTGTTGACAAGGCACTTGTGCTGGAACTGCTCACTGCATTTGCAGCCAAGGAAACCGGACCATCTGGGCTCTCTACTATCCTTGCCACCGCGGCTATCGTTAAAGGCGCGACAGCTAAAGAGCTGGAACCGTTTTCTCCCCTGGTTTCAAAACTCGTAGAACAAGCCGATGAAGCTGACGGCACTATTCTTTTTTTTGAAAGAGGGGCTTACACAACAGCATTCGCGGTGGAGAGCATATTCAGTTTTGCGGCAGCTCTAAAAAAGGCGCCCGTTTTAACCGAACAACAGGTTATAAAATTCGGCAATTTTTTGTACGAAAGACGTCGCGCCCATCAGATTCGCACAGCAGCTCGCGTCGCGTCTGCTTTTAAGGTTTTGGCGACAAATTCCTTCGTGACTCCAGTGGTTGTGTACGGAGCAACGGCTAGTGAACGAGCTGGCGTCTCAGAAATCCTCGTGCCATCATCGCGTCGTCTGCATTTGCGCCTTTTTGACGTTCTTGGCAGGCGATTGGATCCCACTATGAAAGTTGAAGCAGCTGCTCTTTACTCTAACGACGAAGCTGCTTCCAGTGAACCTATTGGTCCATCCAACCTGGGGGAGCTCAAACGAGACAATTCTATTGACGCTTTTGAGTTGGATTTGGGTGCGAAAGTGGGAGCCATTCCGCGCGGTCGTTATGCGTTGGAAATAACCGCTACTGCAACACAAAAGAATGCCTCAAAGGCGCTTCTGGCGGGGGGCGTGAAGTCCAAGATTCCGCTGCGTGTGGTCTCTCCCTTGAAGGTGGACAAGGCCCATATCAAGGTGTCTGATTCTACCAAAAACCTTGTTGATAGTCCCCTGGCAATACCTGGAAGTCGCTACTCAGAAGTTCTTCAACTTCACCACGGCTCTCGTCTTCGTCTCACTTTCGTTCTTGAGGATGGTGTTGCTGCTGCGTCAACAGTAGCACCGCCACCGCCGCCACCTCAACAAGTCTTCATTCAACTGACTCACGGCACCACTCATCAGTCTGTCACGTACATCGCAAGACGATCGACCGTTGATGGGACTTATGCTTTCACTCTCAGTTTGGATGCATCTGTCGAGGACTTCGATCACGTCTCTGGAGTGTACACGATGGAGGTACTTATCGGAGATGCTCTAGTGGAGTCGCCCATTGTCTGGCATGTGGCTGACGTCGATCTTCACTTCCCTCTGAACGAGGACTTCCTCGTTCCCTCGTCCCAACCGGCCTCCGAAGACGTTGCCCGCCTGACCGTGGCCTCGACCTCCGGTCGCAAACGTGCTGTCCATCCACTGATTGGCGACGTGCCCAGCACTACCAAGCCCCTGCTGGAACACACCTTCCGCACTCCGGAACCTCGTCCCTCCGACCTGGTTGCATTCACCTTCACAGGGCTCTGCTGTGCTCCCCTCCTCATCCTCATTTTTGCTTGGCCACTGATGGGAGCCAATCTCTCCAACTTCCCCCTCAGTCTGTCCGCCCCACTCTTCCACCTCGGTCTGGGAGGCATCTTTGGACTCTACCTCCTCTATTGGTTCAAGTTGAACATGTTCACCACTCTTCGTTACCTCCTCTTCCTCGGCATCTTCACCTTCGTTGCGGGCAACCGTCTCCTGCGTCACCTAGTCACCGGGCGACGCAAAGCCCAGGACTAA

>LongOrf.asmbl_18554
RSSKLFRNKSVDSVLEVDWSTAFAALCFEMVTIWCFFALLAAEVIAAPNSNSSPALPIGALDAKDVAHFLAVFSDFNKDNVKDAHYAYIGDSVFNQNILYGLFCDHLKSHFDSLDAEMQYYALSAARGVKSCTPEVSQPNQLKDTLKKEKLTVDQLYYLVSSANIAQVSVDKALVLELLTAFAAKETGPSGLSTILATAAIVKGATAKELEPFSPLVSKLVEQADEADGTILFFERGAYTTAFAVESIFSFAAALKKAPVLTEQQVIKFGNFLYERRRAHQIRTAARVASAFKVLATNSFVTPVVVYGATASERAGVSEILVPSSRRLHLRLFDVLGRRLDPTMKVEAAALYSNDEAASSEPIGPSNLGELKRDNSIDAFELDLGAKVGAIPRGRYALEITATATQKNASKALLAGGVKSKIPLRVVSPLKVDKAHIKVSDSTKNLVDSPLAIPGSRYSEVLQLHHGSRLRLTFVLEDGVAAASTVAPPPPPPQQVFIQLTHGTTHQSVTYIARRSTVDGTYAFTLSLDASVEDFDHVSGVYTMEVLIGDALVESPIVWHVADVDLHFPLNEDFLVPSSQPASEDVARLTVASTSGRKRAVHPLIGDVPSTTKPLLEHTFRTPEPRPSDLVAFTFTGLCCAPLLILIFAWPLMGANLSNFPLSLSAPLFHLGLGGIFGLYLLYWFKLNMFTTLRYLLFLGIFTFVAGNRLLRHLVTGRRKAQD*