Search results


Species: Taenia solium
Id: LongOrf.asmbl_18535
Length: 975
Strand: -
Start: 172631
Stop: 173958
Annotation: K12669 IPR006844|IPR012336|IPR021149 D3TMZ0
Function: Magnesium transporter protein 1|Thioredoxin-like fold|Oligosaccharyl transferase complex, subunit OST3/OST6
Scaffold: Scaffold00154
Sequence:
>LongOrf.asmbl_18535
ATGCGGCTTTACGCTGTCCTGTTATTTGTTAATCTATACCAACAGGCCGTCGAGGCAACGGGTACTCGGGAAATTGACATTCTCGAACAAAAAGTCAAGAGTATTGTATCACTTTTGGATCATTCAAATTTGCTTCCTCTGAACTTCGAAAAATATAATGAGTTTTTGCTCAGGACTCCTCGAAACTATTCGGTTGTTTTGATGCTAACGGCGTTAAGTCACAGGCATAATTGTCACCACTGTCAGCTTGCTGCTGATGAGTTCGCTATCCTTTCTCGGTCCTATCTCCTCTCCAAGAAGGACAAACATGAAATATTCTTTGCGACTGCTGACTATGATGACGACTCGGAGATCTTCACATCTTTAAACCAAAATACGGTACCGGTATTTATCCACTTCCCTCCTACCACCTCGCCGAAAAAGGATGACGTTTATGACATCACACGAAATGGTTTAAGTGCTGAAGTTTTGGCTCAGTGGGTATTCGTGAGGACCGGTGTCCATCTCAACGTTGAAAGGCCTCCTAGTTACTCAGGCCTTTTTCTACTAGCTATATTGATCGGTGTAGGTGGAATAATTTTCCACCTTCGTTCTGAAAATGTAGAGCAATTCTTTAATCGCTCTACAGTTTCGTATATTTGTATGATTCTCATTTTTTACATGATCTCTGGTCAAGTGTGGAATAGTATTCGCCGACCGCCTGCATTTCATTCCTCTGCTGAAGAGGGCCTCGTTCTATTTTACCCCAATAACAATTCACAATTCGTCTCAGAAACCCTCATTATCATGATTACATACGCTCTTGTCTCTTTGAGTATTGTGATCCTGACTGACGTTGCCCAGACGCCGGACTCGAACAAAAGACGAGCGATGGCAGTAGTGGGGACTGCGATGTTTGCTATATTTACAAGCTTATGCTTGTCCCTATTCCGCAAGAAGAACCAGAGTTATCCATACAGCTTTCTTTTGAAATAG

>LongOrf.asmbl_18535
MRLYAVLLFVNLYQQAVEATGTREIDILEQKVKSIVSLLDHSNLLPLNFEKYNEFLLRTPRNYSVVLMLTALSHRHNCHHCQLAADEFAILSRSYLLSKKDKHEIFFATADYDDDSEIFTSLNQNTVPVFIHFPPTTSPKKDDVYDITRNGLSAEVLAQWVFVRTGVHLNVERPPSYSGLFLLAILIGVGGIIFHLRSENVEQFFNRSTVSYICMILIFYMISGQVWNSIRRPPAFHSSAEEGLVLFYPNNNSQFVSETLIIMITYALVSLSIVILTDVAQTPDSNKRRAMAVVGTAMFAIFTSLCLSLFRKKNQSYPYSFLLK*