Search results


Species: Taenia solium
Id: LongOrf.asmbl_17873
Length: 726
Strand: +
Start: 41121
Stop: 42127
Annotation: K00760 IPR000836|IPR005904 GO:0004422|GO:0005737|GO:0006166|GO:0009116 Q5MB11
Function: Phosphoribosyltransferase|Hypoxanthine phosphoribosyl transferase
Scaffold: Scaffold00140
Sequence:
>LongOrf.asmbl_17873
ATGGAATCTCAACCAATGCCCAGGCCTGCCTCTGTGGTAGTGATTCCTGACAACTACCAAAGCTATGAGATTTCACATTTTTGTGTTTCCCCGAAATATCGTGATTACCTGGGAAGCCTTATGATTCCAAATGGCTTGATTAAGGATCGAATTGAGAAGGTTGCCTCGGAGATTATCGAGCACTTTGAGAAGCAGAAAGTCCAGCACATCATTGCAATCTGTGTTTTGAAGGGTGGTTTTAAATTCTGTGTTGACCTTATTGACGCCATGGAGCGGACGATTCGCGCTCGTGGCACTCTCATCCCCATCTCAACCGACTTTGTTCGAATCCGAAGTTATTCGAACACTTCGTCAACTGATTCCATTACTTTGGCTGGTGTTGATGACCCTTCGATTTACAAGGGCAAAGATATTTTGATTGTCGAAGACATTGTTGACTCCGGAAAAACCATGAACAGACTCCACAAGTACTTGGATACCCTTCAAGCCAAATCAGTCACTGATGTCTGTCTCCTAGTTAAAAGAACTCCTCGTAGTTCTGGATACCGGCCTTGCTTTGCTGGTTTTGAAATTCCAGACGACTTTGTTGTTGGCTACGCCCTAGACTACAACGAATATTTTCGAGACCTCCATCACATCTGCGTTCTCAACAAAGCTGGGTTGGAATATTTTGCAGTCCCAGAAGGGCCTGCAAGTCACGCAGTAGAGGAATCCCAAGCCTTCTAA

>LongOrf.asmbl_17873
MESQPMPRPASVVVIPDNYQSYEISHFCVSPKYRDYLGSLMIPNGLIKDRIEKVASEIIEHFEKQKVQHIIAICVLKGGFKFCVDLIDAMERTIRARGTLIPISTDFVRIRSYSNTSSTDSITLAGVDDPSIYKGKDILIVEDIVDSGKTMNRLHKYLDTLQAKSVTDVCLLVKRTPRSSGYRPCFAGFEIPDDFVVGYALDYNEYFRDLHHICVLNKAGLEYFAVPEGPASHAVEESQAF*